Alpha(1,3)-Fucosyltransferase 6 (FUT6) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Human Alpha- (1,3)-fucosyltransferase (FUT6), partial
Gene Names
FUT6; FT1A; FCT3A; Fuc-TVI; FucT-VI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha- (1,3)-fucosyltransferase (FUT6); N/A; Recombinant Human Alpha- (1,3)-fucosyltransferase (FUT6), partial; FUT6 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-359aa; partial
Sequence
RVSQDDPTVYPNGSRFPDSTGTPAHSIPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQLPRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for FUT6 recombinant protein
This protein is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,191 Da
NCBI Official Full Name
alpha-(1,3)-fucosyltransferase 6
NCBI Official Synonym Full Names
fucosyltransferase 6
NCBI Official Symbol
FUT6
NCBI Official Synonym Symbols
FT1A; FCT3A; Fuc-TVI; FucT-VI
NCBI Protein Information
alpha-(1,3)-fucosyltransferase 6
UniProt Protein Name
Alpha-(1,3)-fucosyltransferase 6
UniProt Gene Name
FUT6
UniProt Synonym Gene Names
FCT3A; Fuc-TVI; FucT-VI
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The FUT6 fut6 (Catalog #AAA113403) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-359aa; partial. The amino acid sequence is listed below: RVSQDDPTVY PNGSRFPDST GTPAHSIPLI LLWTWPFNKP IALPRCSEMV PGTADCNITA DRKVYPQADA VIVHHREVMY NPSAQLPRSP RRQGQRWIWF SMESPSHCWQ LKAMDGYFNL TMSYRSDSDI FTPYGWLEPW SGQPAHPPLN LSAKTELVAW AVSNWGPNSA RVRYYQSLQA HLKVDVYGRS HKPLPQGTMM ETLSRYKFYL AFENSLHPDY ITEKLWRNAL EAWAVPVVLG PSRSNYERFL PPDAFIHVDD FQSPKDLARY LQELDKDHAR YLSYFRWRET LRPRSFSWAL AFCKACWKLQ EESRYQTRGI AAWFT. It is sometimes possible for the material contained within the vial of "Alpha- (1,3)-fucosyltransferase (FUT6), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.