Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli LIF Active Protein – Cat# AAA114239 – SDS-PAGE SDS-PAGE

Leukemia Inhibitory Factor Isoform 2 (LIF) E Coli Active Protein

Recombinant Human Leukemia inhibitory factor protein (LIF) (Active)

Average rating 0.0
No ratings yet
Gene Names
LIF; CDF; DIA; HILDA; MLPLI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukemia inhibitory factor protein (LIF); N/A; Recombinant Human Leukemia inhibitory factor protein (LIF) (Active); LIF; D factor; Melanoma-derived LPL inhibitor; MLPLI; Emfilermin; LIF active protein
Ordering

Product Overview

Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized
Sequence Positions
23-23-202aa
Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Species
Homo sapiens (Human)
Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent proliferation of human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of ? 1.0 × 107 IU/mg.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Protein Note
Protein will be provided with aseptic processing and endotoxin removal.
Preparation and Storage
Generally, the shelf life of liquid form is 6 months at -20/-80 degree C. The shelf life of lyophilized form is 12 months at -20/-80 degree C.

SDS-PAGE

E Coli LIF Active Protein – Cat# AAA114239 – SDS-PAGE SDS-PAGE
Related Product Information for LIF active protein
LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
Product Categories/Family for LIF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19.7 kDa
NCBI Official Full Name
leukemia inhibitory factor isoform 2
NCBI Official Synonym Full Names
LIF, interleukin 6 family cytokine
NCBI Official Symbol
LIF
NCBI Official Synonym Symbols
CDF; DIA; HILDA; MLPLI
NCBI Protein Information
leukemia inhibitory factor
UniProt Protein Name
Leukemia inhibitory factor
UniProt Gene Name
LIF
UniProt Synonym Gene Names
HILDA; LIF; D factor; MLPLI

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The LIF lif (Catalog #AAA114239) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-23-202aa. The amino acid sequence is listed below: SPLPITPVNA TCAIRHPCHN NLMNQIRSQL AQLNGSANAL FILYYTAQGE PFPNNLDKLC GPNVTDFPPF HANGTEKAKL VELYRIVVYL GTSLGNITRD QKILNPSALS LHSKLNATAD ILRGLLSNVL CRLCSKYHVG HVDVTYGPDT SGKDVFQKKK LGCQLLGKYK QIIAVLAQAF. It is sometimes possible for the material contained within the vial of "Leukemia inhibitory factor protein (LIF), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.