Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Type III iodothyronine deiodinase Recombinant Protein | IOD3 recombinant protein

Recombinant Rat Type III iodothyronine deiodinase

Gene Names
Dio3; 5DIII; DIOIII
Reactivity
Rat
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Type III iodothyronine deiodinase; N/A; Recombinant Rat Type III iodothyronine deiodinase; 5DIII; DIOIII; Type 3 DI; Type-III 5'-deiodinase; IOD3 recombinant protein
Ordering
Host
Yeast
Reactivity
Rat
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
: 37-271aa(U132S); Partial, provide the complete extracellular domain.
Sequence
DFQCIRRRVLLTAREESTAEHEDPPLCVSDSNRMCTVESLRAVWHGQKLDYFKSAHLGCSAPNTEVVMLEGRRLCKILDFSQGKRPLVVNFGSCTSPPFMARLQAYRRLAAQH VGIADFLLVYIEEAHPSDGWLSTDASYQIPQHQCLQDRLAAAQLMLQGAPGCRVVVDTMDNSSNAAYGAYFERLYIVLEGKVVYQGGRGPEGYKISELRMWLEQYQQGLMGTK GSGQVVIQV
Tag information
EP, YP, BP, MP: Tag type will be determined during the manufacturing process.

The expected tag for each expression system is list as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Tag Info
N-terminal 6xHis-tagged
Note
The amino acid at position 132 is originally a "U", which has already been mutated to be "S" in the above sequence. This is due to the "U", or selenocysteine, which is encoded by UGA, is normally used as a stop codon in prokaryotic cells. Thus leading to early termination of translation. So we have substituted this "U" to simply be an "S" so that translation can proceed. Changing to cysteine may result in undesired disulfide bond formation, so serine is chosen since it is structurally related to both selenocysteine and cysteine.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for IOD3 recombinant protein
Responsible for the deiodination of T4 (3, 5, 3', 5'-tetraiodothyronine) into RT3 (3, 3', 5'-triiodothyronine) and of T3 (3, 5, 3'-triiodothyronine) into T2 (3, 3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing prature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during bryological development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.4kD
NCBI Official Full Name
thyroxine 5-deiodinase
NCBI Official Synonym Full Names
iodothyronine deiodinase 3
NCBI Official Symbol
Dio3
NCBI Official Synonym Symbols
5DIII; DIOIII
NCBI Protein Information
thyroxine 5-deiodinase
UniProt Protein Name
Thyroxine 5-deiodinase
UniProt Gene Name
Dio3
UniProt Synonym Gene Names
Itdi3; Txdi3

Similar Products

Product Notes

The IOD3 dio3 (Catalog #AAA309793) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is : 37-271aa(U132S); Partial, provide the complete extracellular domain. The Recombinant Rat Type III iodothyronine deiodinase reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: DFQCIRRRVL LTAREESTAE HEDPPLCVSD SNRMCTVESL RAVWHGQKLD YFKSAHLGCS APNTEVVMLE GRRLCKILDF SQGKRPLVVN FGSCTSPPFM ARLQAYRRLA AQH VGIADF LLVYIEEAHP SDGWLSTDAS YQIPQHQCLQ DRLAAAQLML QGAPGCRVVV DTMDNSSNAA YGAYFERLYI VLEGKVVYQG GRGPEGYKIS ELRMWLEQYQ QGLMGTK GS GQVVIQV. It is sometimes possible for the material contained within the vial of "Type III iodothyronine deiodinase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.