2',3'-Cyclic-Nucleotide 3'-Phosphodiesterase (CNP) E Coli Recombinant Protein
2',3'-cyclic-nucleotide 3'-phosphodiesterase
Gene Names
Cnp; CNPF; CNPI; Cnp1; CNPII
Applications
Western Blot, ELISA
Purity
>90%
Synonyms
2',3'-cyclic-nucleotide 3'-phosphodiesterase; N/A; Cnp1; CNP recombinant protein
Product Overview
Host
E Coli
Purity/Purification
>90%
Concentration
1 mg/ml; 0.05 mg (varies by lot)
Sequence
EEYKRLDEDLAGYCRRDIRVLVLDDTNHERERLDQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQWQLSLDDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRHFISGDEPKEKLDLVSYFGKRPPGVLHCTTKFCDYGKATGAEEYAQQDVVRRSYG
Sequence Length
420
Applicable Applications for CNP recombinant protein
WB (Western Blot), ELISA
Organism
Rattus norvegicus (Rat)
Storage Buffer
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)
Preparation and Storage
Store at -20 degree C.
Avoid repeated freezing and thawing.
Avoid repeated freezing and thawing.
Related Product Information for CNP recombinant protein
Recombinant protein with His-tag (partial)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19.91KD
NCBI Official Full Name
2',3'-cyclic-nucleotide 3'-phosphodiesterase
NCBI Official Synonym Full Names
2',3'-cyclic nucleotide 3' phosphodiesterase
NCBI Official Symbol
Cnp
NCBI Official Synonym Symbols
CNPF; CNPI; Cnp1; CNPII
NCBI Protein Information
2',3'-cyclic-nucleotide 3'-phosphodiesterase
UniProt Protein Name
2',3'-cyclic-nucleotide 3'-phosphodiesterase
UniProt Gene Name
Cnp
UniProt Synonym Gene Names
Cnp1; CNP; CNPase
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The CNP cnp (Catalog #AAA196549) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's 2',3'-cyclic-nucleotide 3'-phosphodiesterase can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the CNP cnp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EEYKRLDEDL AGYCRRDIRV LVLDDTNHER ERLDQLFEMA DQYQYQVVLV EPKTAWRLDC AQLKEKNQWQ LSLDDLKKLK PGLEKDFLPL YFGWFLTKKS SETLRKAGQV FLEELGNHKA FKKELRHFIS GDEPKEKLDL VSYFGKRPPG VLHCTTKFCD YGKATGAEEY AQQDVVRRSY G. It is sometimes possible for the material contained within the vial of "2',3'-cyclic-nucleotide 3'-phosphodiesterase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.