Product Overview
Host
Yeast
Reactivity
Rat
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
Tris-based buffer, 50% glycerol
Sequence Positions
Partial, 671-746aa
Sequence
SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQRRARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL
Brief Description
Recombinant Protein.
Tag Info
N-terminal 6xHis-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability
of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Related Product Information for C3 recombinant protein
C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
11 kDa
NCBI Official Full Name
complement C3
NCBI Official Synonym Full Names
complement C3
NCBI Official Symbol
C3
NCBI Protein Information
complement C3
UniProt Protein Name
Complement C3
UniProt Gene Name
C3
UniProt Synonym Gene Names
C3bc; ENCF-2; ENCF-1; ASP
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The C3 c3 (Catalog #AAA309812) is a Recombinant Protein produced from Yeast and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Partial, 671-746aa. The Recombinant Rat Complement C3 (C3), partial reacts with Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: SVQLMERRMD KAGQYTDKGL RKCCEDGMRD IPMPYSCQRR ARLITQGESC LKAFMDCCNY ITKLREQHRR DHVLGL. It is sometimes possible for the material contained within the vial of "Complement C3 (C3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
