Survivin Recombinant Protein | BIRC5 recombinant protein
Recombinant Human Survivin (SURV) Protein
Gene Names
BIRC5; API4; EPR-1
Purity
> 95 % as determined by SDS-PAGE.
Synonyms
Survivin; N/A; Recombinant Human Survivin (SURV) Protein; BIRC5; API4; EPR-1; Baculoviral Inhibitor Of Apoptosis Repeat Containing 5; Apoptosis Inhibitor 4; Survivin Variant 3 Alpha.; BIRC5 recombinant protein
Host
E. coli Full length protein (O15392).
Purity/Purification
> 95 % as determined by SDS-PAGE.
Form/Format
In 0.15M PBS, pH 7.4-7.5, 8M urea, 50% glycerol.
Concentration
1mg/ml (varies by lot)
Sequence
MHHHHHHGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAEKVRRAIEQLAAMD
Source
Human
Protein Residues
with N-terminal His-tag.
Usage
SURV Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Store under sterile conditions at -20°C upon receipt. It is recommended to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 12 months from date of receipt at -80°C.
**Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 12 months from date of receipt at -80°C.
Related Product Information for BIRC5 recombinant protein
Survivin is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors yet low in adult tissues. Antisense transcripts are involved in the regulation of this gene's expression. At least four transcript variants encoding distinct isoforms have been found for this gene, but the full-length natures of only three of them have been determined.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted MW: 17 kDa
Observed MW: 17 kDa
Observed MW: 17 kDa
NCBI Official Full Name
baculoviral IAP repeat-containing protein 5 isoform 2
NCBI Official Synonym Full Names
baculoviral IAP repeat containing 5
NCBI Official Symbol
BIRC5
NCBI Official Synonym Symbols
API4; EPR-1
NCBI Protein Information
baculoviral IAP repeat-containing protein 5
UniProt Protein Name
Baculoviral IAP repeat-containing protein 5
UniProt Gene Name
BIRC5
UniProt Synonym Gene Names
API4; IAP4
UniProt Entry Name
BIRC5_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The BIRC5 birc5 (Catalog #AAA13290) is a Recombinant Protein produced from E. coli Full length protein (O15392). and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MHHHHHHGAP TLPPAWQPFL KDHRISTFKN WPFLEGCACT PERMAEAGFI HCPTENEPDL AQCFFCFKEL EGWEPDDDPI EEHKKHSSGC AFLSVKKQFE ELTLGEFLKL DRERAKNKIA KETNNKKKEF EETAEKVRRA IEQLAAMD. It is sometimes possible for the material contained within the vial of "Survivin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
